PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g030100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27709.9 Da    PI: 10.4684
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g030100.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.46.7e-271058250
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      ri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsst kly+y+
  Sopen12g030100.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTSKLYDYA 58
                      8***********************************************8 PP

2K-box91.61.4e-30841721199
             K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       +++ + +q+e+a L++++enLqr++R+++Ge+L+ L++k+Lq+Le+qLe+sl+ +R kK+++l+++++el +k +  ++enk+L+kkl+
  Sopen12g030100.1  84 TSEVKFWQREAALLRQQLENLQRNHRKMMGEELSGLNVKDLQNLEKQLETSLRGVRVKKDQILINEVQELNRKRNFSHQENKDLHKKLD 172
                       67899*********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.95161IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-37160IPR002100Transcription factor, MADS-box
CDDcd002651.27E-41275No hitNo description
SuperFamilySSF554559.16E-31278IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-2785171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.70387177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRGKILIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TSKLYDYANT  60
SMKSVIERYN KAKEDNTYKL GDPTSEVKFW QREAALLRQQ LENLQRNHRK MMGEELSGLN  120
VKDLQNLEKQ LETSLRGVRV KKDQILINEV QELNRKRNFS HQENKDLHKK LDIVRRENME  180
LYKKVYGNRD ANAVSKMAMS SSSLSVKEDP LAPLHLQLSQ PQLQHYEMPG TTKLRLSLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P2e-19174174Myocyte-specific enhancer factor 2B
1tqe_Q2e-19174174Myocyte-specific enhancer factor 2B
1tqe_R2e-19174174Myocyte-specific enhancer factor 2B
1tqe_S2e-19174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754512e-96HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060173.11e-177PREDICTED: MADS-box transcription factor 23-like
SwissprotA2RVQ51e-100AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLK4DGN01e-123K4DGN0_SOLLC; Uncharacterized protein
STRINGSolyc12g088090.1.11e-123(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6792056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.16e-85AGAMOUS-like 16